5% Off for New Customers

MAYFEYR - Fendi - Sneakers - 7E1689AOS0F1PXW
Vendor:Fendi

Sneakers

US$1,450
36% Off
Oversized Blazer
Vendor:Balenciaga

Oversized Blazer

Sale price US$2,650 Regular price US$4,110
29% Off
MAYFEYR - Gucci - Orange Printed Silk Skirt With Horsebit Motif - 832799ZAS9N7033
Vendor:Gucci

Orange Printed Silk Skirt With Horsebit Motif

Sale price US$990 Regular price US$1,390
36% Off
MAYFEYR - Patou - 3D Knit Dress - KN1718070001W
Vendor:Patou

3D Knit Dress

Sale price US$695 Regular price US$1,090
42% Off
MAYFEYR - Burberry - Wool Tailored Trousers - 8082792B8640
Vendor:Burberry

Wool Tailored Trousers

Sale price US$855 Regular price US$1,470
23% Off
MAYFEYR - Gucci - Infinity Print Swimsuit - 790916XHAKF2051
Vendor:Gucci

Infinity Print Swimsuit

Sale price US$870 Regular price US$1,130
5% Off
MAYFEYR - Forte Forte - Printed Blazer Jacket - 14629MYJACKETGLICINE
Vendor:Forte Forte

Printed Blazer Jacket

Sale price US$885 Regular price US$930
20% Off
MAYFEYR - Stella Mccartney - Top - 6T02923HS3674320
Vendor:Stella Mccartney

Top

Sale price US$1,425 Regular price US$1,790
7% Off
MAYFEYR - Diesel - Top White - A141890DLAX100
Vendor:Diesel

Top White

Sale price US$485 Regular price US$520
10% Off
Skirts Black
Vendor:Courreges

Skirts Black

Sale price US$655 Regular price US$730
31% Off
MAYFEYR - Givenchy - Monogram 72 Jacquard Polo Style Dress - BW22B74ZPN001
Vendor:Givenchy

Monogram 72 Jacquard Polo Style Dress

Sale price US$1,625 Regular price US$2,370
38% Off
MAYFEYR - Givenchy - Wrap-Around Shirt - BW619215JT100
Vendor:Givenchy

Wrap-Around Shirt

Sale price US$1,300 Regular price US$2,090
26% Off
MAYFEYR - Balenciaga - Top "Lingerie" - 8292144F4B41094
Vendor:Balenciaga

Top "Lingerie"

Sale price US$1,200 Regular price US$1,620
28% Off
MAYFEYR - Maison Margiela - Pants With Pleats - S51KA0601M35289800
Vendor:Maison Margiela

Pants With Pleats

Sale price US$1,100 Regular price US$1,520
9% Off
Hooded Jacket
Vendor:Dolce & Gabbana

Hooded Jacket

Sale price US$1,950 Regular price US$2,153
25% Off
MAYFEYR - Palm Angels - Straight Leg Jeans - PMYA039R24DEN0014010
Vendor:Palm Angels

Straight Leg Jeans

Sale price US$870 Regular price US$1,160
2% Off
MAYFEYR - Burberry - Straight Jeans - 8099386C1765
Vendor:Burberry

Straight Jeans

Sale price US$1,025 Regular price US$1,050
15% Off
MAYFEYR - Balenciaga - Hourglass Jacket - 773776TJW794076
Vendor:Balenciaga

Hourglass Jacket

Sale price US$2,050 Regular price US$2,420
3% Off
MAYFEYR - Valentino - Upvillage Sneaker - 6Y2S0H77LALRJA
Vendor:Valentino

Upvillage Sneaker

Sale price US$1,125 Regular price US$1,160
34% Off
MAYFEYR - Burberry - Shirt With Check Pattern - 8081047B8789
Vendor:Burberry

Shirt With Check Pattern

Sale price US$1,525 Regular price US$2,300
1% Off
MAYFEYR - Marine Serre - Upcycled Linen Pants - UPA056AUWOV0007WH10
Vendor:Marine Serre

Upcycled Linen Pants

Sale price US$1,100 Regular price US$1,110
39% Off
MAYFEYR - Fendi - Wool Jacket - FJ0798AR8TF1MTE
Vendor:Fendi

Wool Jacket

Sale price US$2,125 Regular price US$3,500
3% Off
MAYFEYR - Alexander Mcqueen - Rugby Polo - 809764QXABW1080
Vendor:Alexander Mcqueen

Rugby Polo

Sale price US$1,025 Regular price US$1,060
12% Off
MAYFEYR - Burberry - Cropped Shirt - 8101121C1849
Vendor:Burberry

Cropped Shirt

Sale price US$870 Regular price US$990
7% Off
MAYFEYR - Dolce & Gabbana - Oversize Jeans - GWVNXZG8MU3S9001
Vendor:Dolce & Gabbana

Oversize Jeans

Sale price US$1,075 Regular price US$1,156
14% Off
MAYFEYR - Isabel Marant - Top "Sonae" - HT0607FAC1J16IBKEC
Vendor:Isabel Marant

Top "Sonae"

Sale price US$810 Regular price US$940
30% Off
MAYFEYR - Givenchy - Bermuda Chino Xl - BM51F315FH250
Vendor:Givenchy

Bermuda Chino Xl

Sale price US$1,050 Regular price US$1,510
22% Off
MAYFEYR - Burberry - Shirt "B" - 8087852B9593
Vendor:Burberry

Shirt "B"

Sale price US$1,475 Regular price US$1,880
22% Off
MAYFEYR - Alexander Mcqueen - Military Pants - 774166QUAAC1000
Vendor:Alexander Mcqueen

Military Pants

Sale price US$1,250 Regular price US$1,600
15% Off
MAYFEYR - Burberry - All Over Print Bermuda Shorts - 8089043B9593
Vendor:Burberry

All Over Print Bermuda Shorts

Sale price US$1,175 Regular price US$1,380
33% Off
Printed Silk Twill Shirt
Vendor:Gucci

Printed Silk Twill Shirt

Sale price US$1,400 Regular price US$2,100
20% Off
MAYFEYR - Burberry - Shirt "B" - 8090731B9555
Vendor:Burberry

Shirt "B"

Sale price US$1,500 Regular price US$1,880
1% Off
MAYFEYR - Alexander Mcqueen - Bermuda With Logo - 781880QXAAM1000
Vendor:Alexander Mcqueen

Bermuda With Logo

Sale price US$890 Regular price US$900
6% Off
MAYFEYR - Marni - Cotton Shorts - PAMA0543S0UTC462DIB26
Vendor:Marni

Cotton Shorts

Sale price US$855 Regular price US$910
30% Off
Flare Fit Pants
Vendor:Stella Mccartney

Flare Fit Pants

Sale price US$890 Regular price US$1,050
16% Off
MAYFEYR - Ferragamo - Shoulder Bags - 769385215971
Vendor:Ferragamo

Fiamma Small Calfskin Crossbody Bag - Black

Sale price US$1,925 Regular price US$2,280
50% Off
MAYFEYR - Maison Margiela - Distressed-Effect Ecru Sweatshirt - S50GU0227M25022102
Vendor:Maison Margiela

Distressed-Effect Ecru Sweatshirt

Sale price US$1,410 Regular price US$2,820
3% Off
MAYFEYR - Rick Owens - Jumbo Sweatshirt - CM01E1669CHFE09
Vendor:Rick Owens

Jumbo Sweatshirt

Sale price US$840 Regular price US$870
10% Off
MAYFEYR - Celine - Capsule Bags Yellow - 123832O9011YN
Vendor:Celine

Triomphe Canvas Medium Canvas Shopper Tote - Yellow / Navy

Sale price US$1,800 Regular price US$1,991
50% Off
MAYFEYR - Valentino - Lilac Silk Mini Dress - 6B3VAEW11MMR3H
Vendor:Valentino

Lilac Silk Mini Dress

Sale price US$2,440 Regular price US$4,880
49% Off
MAYFEYR - Maison Margiela - White Reversed Shirt T-Shirt - S51NF0003MTJ031102
Vendor:Maison Margiela

White Reversed Shirt T-Shirt

Sale price US$890 Regular price US$1,740
44% Off
MAYFEYR - Fendi - White Denim Jacket - FW1321AUAHF0QA0
Vendor:Fendi

White Denim Jacket

Sale price US$1,350 Regular price US$2,430
28% Off
Tobacco Brown Silk Striped Scarf
Vendor:Fendi

Tobacco Brown Silk Striped Scarf

Sale price US$680 Regular price US$950
50% Off
Blue Silk Jacquard Dress
Vendor:Fendi

Blue Silk Jacquard Dress

Sale price US$2,370 Regular price US$4,740
16% Off
MAYFEYR - Samantha Sung - Dresses Pink - AUDREYDRESSSHIRTLILACHEAVENWHITEWHITEPINK
Vendor:Samantha Sung

Dresses Pink

Sale price US$1,025 Regular price US$1,220
21% Off
MAYFEYR - Max Mara - Century Dress - 2511221104600301004
Vendor:Max Mara

Century Dress

Sale price US$1,375 Regular price US$1,730
26% Off
Wide Leg Pants
Vendor:Bottega Veneta

Wide Leg Pants

Sale price US$1,150 Regular price US$1,520
28% Off
MAYFEYR - Fendi - Wool Pants - FB0979AR8SF0QA1
Vendor:Fendi

Wool Pants

Sale price US$1,075 Regular price US$1,500
Vendor:Bottega Veneta

Ribbed Cotton Jersey Top

Sale price US$730 Regular price US$877
3% Off
MAYFEYR - Comme Des Garcons - T-Shirts And Polos Ivory - GQT0200511
Vendor:Comme Des Garcons

T-Shirts And Polos Ivory

Sale price US$825 Regular price US$850

Need Help? Email: care@mayfeyr.com

© 2026 MAYFEYR - All rights reserved.
575 5th Ave, Fl 14, New York, NY 10017. 
  • American Express
  • Apple Pay
  • Google Pay
  • Mastercard
  • PayPal
  • Union Pay
  • Visa